PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G189100.1
Common NamePHAVU_003G189100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family M-type_MADS
Protein Properties Length: 484aa    MW: 54805.6 Da    PI: 9.1394
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G189100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF70.31.7e-22140183245
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
              SRF-TF   2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45 
                         + e+ snr+vt+skR+ gilKKA+ELS+LCd+++++++fs+tgk
  Phvul.003G189100.1 140 KLESISNRHVTYSKRKSGILKKAKELSILCDIDILLLMFSPTGK 183
                         57899*************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.983131183IPR002100Transcription factor, MADS-box
SMARTSM004324.0E-28131190IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.31E-23132225IPR002100Transcription factor, MADS-box
CDDcd002661.50E-23132214No hitNo description
PRINTSPR004042.9E-16133153IPR002100Transcription factor, MADS-box
PfamPF003194.0E-19142184IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-16153168IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-16168189IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 484 aa     Download sequence    Send to blast
LGCAWRGRRG KHKGRRERGK CVGFVGRGGV CCIGCQRLGS PKSHPSYSCY ELGWFPKLNP  60
PKSQLHLSSS NNLLALRYHI QLSFFLSTRH LPINKCCCDS SVTSHLHPFY FNISIHFPRF  120
FSSVFTLSIR MGRVKLKIKK LESISNRHVT YSKRKSGILK KAKELSILCD IDILLLMFSP  180
TGKPTLLQGE RSNIEEVVAK FGQLSPQERA KRKMESLEAL KKTFKKLDHD VKIQDFLGSS  240
SQTMEELSHQ VRVLQAQLTE VHQRLSYWNN LEKINNLEHL RQMEDSLRES INRVVLQKEN  300
LGKHQFISLE CANQLQEGMT LPLMMASLQE SQPLSWLLNN DNHQLLLPNE PKFLPFSDNT  360
NRDAECSTDI SIPSYSSYIG SHKLEVGSSP QVTTLGQGGG AMNELNGTTY LNVQRCDQFT  420
FPPPQDIEEA KHLPTLNNKS NTVDYQVNNF DLSGSLFENG HQFWNSASGS CGIAMYNENG  480
YHR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S1e-13131222190Myocyte-specific enhancer factor 2B
1tqe_R1e-13131222190Myocyte-specific enhancer factor 2B
1tqe_Q1e-13131222190Myocyte-specific enhancer factor 2B
1tqe_P1e-13131222190Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007155298.10.0hypothetical protein PHAVU_003G189100g, partial
SwissprotQ7X9I09e-95AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLV7CAT10.0V7CAT1_PHAVU; Uncharacterized protein (Fragment)
STRINGGLYMA17G10941.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27503370
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.11e-83AGAMOUS-like 65